Tag Archives: Diazepam

MedValue Anesthesia Tape, Diazepam mg/mL, 1-1/2″ x 1/2″, Orange – 500 Inches Per Roll

Anesthesia drug syringe tape conforms to the nationally-recognized color coding ASTM standard D-4774-93 and helps meet the Joint Commission NPSG 03.04.01.Anesthesia Tape, Diazepam mg/mL, 1-1/2″ x 1/2″ This Listing Is For Anesthesia Tape Qty : 500 Inches Per Roll Size (w x h) : 1-1/2 ” x 1/2″ Color : Orange Adhesive : Removable; Material… Read More »

Focus On: 100 Most Popular World Health Organization Essential Medicines: Essential Medicines, Paracetamol, Diazepam, Lorazepam, Ketamine, Aspirin, Azithromycin, … Metformin, Amoxicillin, Metronidazole, etc.

This carefully crafted ebook is formatted for your eReader with a functional and detailed table of contents. The Focus On books are made out of collections of Wikipedia articles regrouping the most informative and popular articles about a specific subject. The Focus On books are a result of a substantial editorial work of selecting and… Read More »

Silver Valium (R) Diazepam Necklace Pendant 60cm Zinc Alloy Two Sided Pill Drug Chain

This listing is for what is exactly pictured! A double sided pendant that says “Valium (R)” on one side and “Roche Roche” on the other. And yes, it is cut out in the middle like real deal! Silver plated Valium pendant – Comes with a silver coated Valium pendant that is double sided with Roche… Read More »

Diazepam Binding Inhibitor (DBI) (10ug)

Homo sapiens (Human) two N-terminal Tags, His-tag and S-tag protein expressed from E.coli Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF TGKAKWDAWN ELKGTSKEDA MKAYINKVEE LKKKYGI High-Quality Protein Shipped with Protein Data Information Sheet Multiple Quantities Available Please Request Further Information If Needed